GenomeNet

>pin:Ping_0685 thymidine kinase (EC:2.7.1.21); K00857 thymidine kinase [EC:2.7.1.21] (A)
MAQLYFYHSTMNAGKSTSLLQSAYNYRERGMQCLVMTPSIDNRAGVGKVASRIGLECDAQ
LFSGEDNLAKMIEIAHRVEHQHCILIDEAQFLTKEQVKQLTWIVDKLSIPILCYGIKTDF
QGELFTGSHYLLAWADKLVELKTICHCGRKANMVLRLDKQGKPITKGAQVEIGGNESYES
VCRKHFRIFIWD

BLAST