GenomeNet

>pit:PIN17_A0177 no KO assigned | (GenBank) alpha amylase, catalytic domain protein (A)
MAMFAQGWKANYGGVMLQGFYWDSYQDTKWTNLESQAKEFSDYFDLVWLPQSAQARNNPS
MGYDDYYWFSNYNSSFGTEAELLSLIGTFKANGIKTIADVVINHRATTAGWFDFPTETYN
NVTYTMTSKDVAKNDDGGEALKQAQKEGVQLSDFMDSGEDWPGMRDLDHNSANVQTTVKA
YLQMLKDKFGYAGFRYDMVKGYGGKFTALYNNASQPEFSVGEYWDGDLNKVKAWIESTKS
DNVPTSAAFDFPIRYTVRNAVNNGNWSAFDGIGLAKDPNYARYAVTFVENHDTEDRGGNS
HQDPIKKDTLAANAYILAMPGTPSIFLKHYQAYKSDIKNMISVRKLMGINNESKAAKYSS
SSDYYAFTTTGTNGEMLTVLGPAKSFSNTNRWIKLTGGYHWAYYVEKSKANFVWASLASG
TYDGEQSVMLTAISDDANAQIVYTTDGSEPTAGSAKATNGQVLTIPVGTTVLKAGLLVGG
VVKNVIVRNYNIIDFKPYNIKVYVNADEADAAWASAKMTSTNPSINFWIWGGTHKTVKGS
WPGDAVTTTETANGKKWFVKEFAITNSNDIVNLVFSVGTGSPQTVDIENIKATTFISISS
EKEGGKNKVNVVSTDIDNVVAEQKGNNDPYYYTLSGQRIAKPTQRGIYIHNGKKVLVK

BLAST