GenomeNet

>pit:PIN17_A1240 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) tdk; thymidine kinase (A)
MVAIDNLNGERRRQGRIEVICGSMFSGKTEELIRRMKRAKFAKQKVEIFKPAIDMRYSEE
DVVSHDQNAIRSTPINSSGNILLLASDIEVVGIDEAQFLDEGLVDICNQLANNGVRVIVA
GLDMDFKGVPFGPIPSLCAVADQVTKVHAICVKCGALAYASHRLVDNDHRVMLGEQMEYE
PLCRECYQKALSEEMQRKQSNP

BLAST