GenomeNet

>pjd:Pjdr2_0339 tgl; transglutaminase (EC:2.3.2.13); K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] (A)
MLQISGTDAGDINPFALTPVERDVLQGKQNSPVVYQYDSMDSLRFELRLRDRTVNAARML
QDSRADFAVFRNSRCNPRYWTRTENGGFQMNPDVQPSDAINDIFQNGENYGFECATAIVI
VLYKAVLDTIGEQAFNKLFNPLYLRDWNHDSDLWFITTHNKNESYPGDVMYFRNPDFDRE
TPEWQGENVVKLSDNLFFGHGIGVETGEQIVSALNRMREPFSTESAYLDDLVVHPNFQHL
KQIAARGSRFAVRL

BLAST