GenomeNet

>pjd:Pjdr2_0339 K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] | (GenBank) Protein-glutamine gamma-glutamyltransferase (A)
MLQISGTDAGDINPFALTPVERDVLQGKQNSPVVYQYDSMDSLRFELRLRDRTVNAARML
QDSRADFAVFRNSRCNPRYWTRTENGGFQMNPDVQPSDAINDIFQNGENYGFECATAIVI
VLYKAVLDTIGEQAFNKLFNPLYLRDWNHDSDLWFITTHNKNESYPGDVMYFRNPDFDRE
TPEWQGENVVKLSDNLFFGHGIGVETGEQIVSALNRMREPFSTESAYLDDLVVHPNFQHL
KQIAARGSRFAVRL

BLAST