GenomeNet

>pkn:PKH_031080 hypothetical protein; K11428 histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43] (A)
MKTSTSYSFSHAKANASENTNDNCSGDKCSASENIFTNAASVIWIEKEKLDSIIHIPVYS
DLSKYVCDLNKHPVKQKKEEEAEGGMLSRIFLLFDDNSCNIALDISAIYESDNGKIPLLI
YERYYFWSLHFLFEKSKIKRQKLNIYTDTNGRCRISNINKCDDDVYMYTSIYNCAYNRND
SEKNVGVTSYPELGRNNYKDVNKELAICDKDYIKYLYLSDLKNIAMMESTTKSGHCGVQG
RAGHGGTLSKNSGDAFKGGASIGNPLFEKGLYPNKEIKWYRLKMKIESVEKKNKSENKNF
TKGKAFPISSHHFSLNNCKKKKYNITGNRNVDMCHNRNRGFTYEQKNLNNPRNFKKEPCD
PIFNANALHSISHFSLIDNDTTRESINNLIKIQKRSFSMLKQENEKKLLDIANDERLLLS
SNGKSESVFDVHKRESLSSYGNHIGKRRKKSKWFYYRSSSNETNLGLDDGDGSTSRGNSV
CAVNGGVAHMDNKRKRQEGDSGCEFGDGHKNAEGRGHDKGDIQQGQERDNRQDVPCRSFS
SCDSVCTPSRTRSGNSKGVHSPKGRKPPDGYTHEGAEDSFTNSRIPADSRAYVRTIHAGE
SGTEFHSFDVEEDVDGIESAPLVAIDPSEKKRNREEREVKQNELFIEEMKKMNSGVLTQN
TKVYQENIDKYNSEFQSIISEPFDQKERREKIKKRRDQNREIQMMYLNKILKSMVNKEKS
HLNCLSKNFKRIEGFYKQNYKIYIIESKSDLNYKKNCFKTDVHVYDLFAPSGDNISKEVN
ILDEFKMYLRRCKGEYRPRKYQTHITTGDRKSMDGGKSGVDFQRECTWTEMKEHSKENGP
DDNHERENEQKDTPMKNSLTKMIPKGRAVPADGEGEGEGGRGGGGELAEAGATVELTVKV
EEPYSGSSQREVIKTNLTNQTPPEDGIIFYAHNKNNTSNVKEIKEGDILYIKFDNTSDDY
DKIRIVKKEDLLQILIFLMRNQECLKLSNISTYSPDLLWNLSVHFKNNTYDMESNLEKMY
NHFCRRYEVISPDGGLSSDPHLEFAPVVQRGHVRQFHSSFDQPSHLPFHSPFDSPFDSRL
VEQADRQPGFSPEWSSENLSDCSSVTVSESTAKATKGARKFKSTKGVKRESLKEIETMKL
KDYVSFLDKFLQNVNEVKLKRLKSIKTEYYEKYEFDRTINKLNRQQLLDLFVDKKNEVNT
IPLSFLKEKSRNIIYEENIKMNMFACIKIIFDDVKGRCIYAASDLNKFDFVFEYVGELLT
HNEAMERERKYNKNNKKGCYMFYFKHENKRYCIDGTEENIEAAINNKDKKYFLRSFARLV
NHSKKNSNLIPKVLTVASQPRLFFVAARNIKEGEELLIDYGERDREIIKNNEWLKC

BLAST