GenomeNet

>pkn:PKH_070970 K01113 alkaline phosphatase D [EC:3.1.3.1] | (RefSeq) hypothetical protein (A)
MKNCVILLFLFCACIKYVSCHADQIINEKLTNLVFLSCNYHKGKTNDKLIKSVEKKKPQL
MLWVGDYFYSECKDLKCLYEAYDYIKKDPFYIGLKEKFVIDGIYDDHDYNKNNGDRLYEH
KKESKTQFLNYMNVPKNDVRYKRNGAYISKLYIDPENEKNQVKIIILDTRYNKDPYPFYA
PDSYHDSFMHMFVSFVVRFHAALFGLYCDSKNDILGNEQWAWLEKELTNSSARAHIVISS
TQIFSNHIVNENWGLMPFAQKKLKHLMNKTKPKGLIFLSGDVHFASILGNEENVVEVTSS
SVNQENIFSYINKYFIYFSTYFLNKKSPFELDKIFAFNNFGSLSISYINDDEIRIKSVIH
DSDGNEILVANQSFNKKKNAYKKTQNLHLLHDDIATFSCKSNSKVCIHIIIYVLFVLWFL
QIIFIFCKLLGFCKKKKVADKRKGE

BLAST