GenomeNet

>plu:plu1865 K01841 phosphoenolpyruvate phosphomutase [EC:5.4.2.9] | (GenBank) unnamed protein product; Truncated gene. Some similarities with putative phosphoenolpyruvate phosphomutase (A)
MRCGMSALTDSAVKGIPDNETLDINSRLQNIHEIKLLTKMPVIMDADTGGRVEHFVHYVR
KMEQVGIDAVIIEDKTGNKRNSLFGTSVKQELADIKEFSNKIAKGKAAQQKSRLMIFARL
ESLIAGYGMEDALERANAYVKAGANGIMIHSCQNTSDEVIDFSQSFRKKYPKLPLICVPT
TYSATYHHDLSEAGFNIIIYANHMLRAAYKAMEHVSHEILKYGRSAEVEKDCISIKKVIN
LIPYAS

BLAST