GenomeNet

>plu:plu1865 hypothetical protein; K01841 phosphoenolpyruvate phosphomutase [EC:5.4.2.9] (A)
MRCGMSALTDSAVKGIPDNETLDINSRLQNIHEIKLLTKMPVIMDADTGGRVEHFVHYVR
KMEQVGIDAVIIEDKTGNKRNSLFGTSVKQELADIKEFSNKIAKGKAAQQKSRLMIFARL
ESLIAGYGMEDALERANAYVKAGANGIMIHSCQNTSDEVIDFSQSFRKKYPKLPLICVPT
TYSATYHHDLSEAGFNIIIYANHMLRAAYKAMEHVSHEILKYGRSAEVEKDCISIKKVIN
LIPYAS

BLAST