GenomeNet

>plu:plu3091 unnamed protein product; Highly similar to probable aminotransferase YfbQ of Escherichia coli; K14260 alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2] (A)
MLAVKKSSKLDNVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFEAPDEILVDVIR
NLPTAQGYSDSKGLYSARKAIMQHYQARNMMDVTVEDIYIGNGVSELIVQAMQALLNTGD
EMLVPAPDYPLWTAAVSLSSGKAVHYMCDEGSDWFPDLNDIRNKITPRTRGIVIINPNNP
TGAVYSKELLLEVVEIARQHNLIIFADEIYDKILYDDAEHHSIAALAPDLLTVTFNGLSK
TYRVAGFRQGWMVLNGPKKHAKSYIEGLEMLASMRLCANVPMQHAIQTALGGYQSISEFI
LPGGRLYEQRNRAWELINQIPGVSCVKPKGALYMFPKIDAKRFNVHDDQKMVLDLLLQEK
VLLVQGTAFNWPEPDHLRIVTLPRLDELEMAIQKFARFIGKYHQ

BLAST