GenomeNet

>pmi:PMT9312_0550 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (A)
MSKKYDAGVKEYRDTYWTPEYVPLDTDLLACFKCTGQEGVPREEVAAAVAAESSTGTWST
VWSELLTDLEFYKGRCYRIEDVPGDPEAFYAFIAYPLDLFEEGSITNVLTSLVGNVFGFK
ALRHLRLEDIRFPIAFIKTCGGPPNGIVVERDRLNKYGRPLLGCTIKPKLGLSGKNYGRV
VYECLRGGLDLTKDDENINSQPFQRWRERFEFVAEAVKLAQQETGEVKGHYLNCTANTPE
ELYERAEFAKELDMPIIMHDYITGGFTANTGLANWCRKNGMLLHIHRAMHAVIDRHPKHG
IHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGYIDNLRESFVPEDRSRGNFFDQDW
GSMPGVFAVASGGIHVWHMPALLAIFGDDSCLQFGGGTHGHPWGSAAGAAANRVALEACV
KARNAGREIEKESRDILMEAAKHSPELAIALETWKEIKFEFDTVDKLDVQG

BLAST