GenomeNet

>pmi:PMT9312_1155 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ATP-dependent DNA ligase (A)
MKNEKISLSFTEGSSDKVYQAELKEVDGGFNVTFQYGRRGKPLQSGTKTKTPATYDDAKK
IYDKLVLSKTSKGYAPEDSSVEYAETEKAGESTDFKPQLLNPINNENLEELFNNFSRVYM
QTKHDGERRGASINNSEIIASNRKGLRVGLQKPIQDALEKLKDGGFIDTEIDSEDMGDHL
VIFDVLKFKGLETKENSFSDRVTYLEKLGEEIKSKKLDNALKVDYPTIADSLEKVKDFVE
SAKSKNEEGVVFKNGDATYNEGRPSSGGNALKLKFVESATLRVSSITEGKRSVSIEINDN
GIWISVGKCTVPANQDIPNPGELIEVDYLYAIKDGALFQPIYKGKRNDLDETAAVISQLK
YKKD

BLAST