GenomeNet

>pmm:PMM0384 K01155 type II restriction enzyme [EC:3.1.21.4] | (GenBank) spnII-interrupted-C; possible uncharacterized restriction enzyme, interrupted-C (A)
MAKDFFYKRYEGNPKIYAYSDSHPQYQGLLKVGFTSKNTVKQRVEAQYPIITPGEETYTI
HLDRSAIRKDGTSFIDKDVHKILRAKGFPNPAGEWFRCKVTDVNAAIDLVAFGDIGVEGR
PNNFGLRPEQKEAIEKTKNYINGFIKEKSNKVPHFLWNAKMRFGKTFAAYKLALEMKWTK
VLVLTFKPAVQSAWEEDLLTHIDFEGWQFINRNGMSFGEADKSKPFVCFGSFQDFLGKNN
AGGIKPKNEWVHTIKWDCVILDEYHYGAWRERAKELFEGEENKEIKLQEGEGISFFKEEN
MPISTNFYLYLSGTPFRAISTGEFIEEQIFNWTYSDEQNAKNNWVGDKNPYSSLPRMILM
TYKVPDYILEVANEGEFDEFDLNTFFSAKYEDDASEFIYKDEVQKWLDLIRGQNLEEIKT
TLKLKDKKPPYPFSDSRLLSLLSHTFWYLPNVSSCFAMRNLLQERQNTFFHSYKIIVAAG
NKAGLGLKALWPVRDAMDNPLESKSITLSCGKLTTGVSVKPWSGIFMLRNISSPETYFQS
AFRVQTPWEIENPDSKSPNEKDVLKHNCYVFDFAPNRALTQISDYSCNLNYQENDPEKKV
GEFIKFLPVLSYDGSSMIEVDATSILDMTISGTTATLLARRWESALLVNVDNSTLERLMG
NDEAMKALQAIEGFRSLNEDITSIINSSESIKNLKTKANEEELNKKEKKQLTEQEKEFIN
LRKKIQKQLIKFATRIPIFMYLTDYRERSLKDVITQLEPGLFKKVTGLSLKDFDLLISLN
VFNSSLMNDAIYNFKRYEDSSLSYIGLTKNTHDEVGLFDTVISREEFEI

BLAST