GenomeNet

>pmq:PM3016_6667 XylA protein; K01805 xylose isomerase [EC:5.3.1.5] (A)
MSIFKNVPKIAYEGRNSDNPFAFKHYNPQEVVLGKTMEEHLRFAVAYWHTYTANGTDPFG
VGTMVRAWDSYSGLDQAKKRVEANFEFLDKIGVPYFCFHDRDIAPEGETLQETNKNLDVI
VAMTKEYMQSSGKKLLWNTANMFSNPRFVHGAGTTNNADVFAYAAAQVKKGLEVGLELGA
ENYVFWGGREGYETLLNTNMKLELDNLARLLHMAVDYAKEIGFGAQFLIEPKPKEPTKHQ
YDFDAATTIAFLQNYGLKEHFKLNLEANHATLAGHTFEHELHVARINGMLGSLDANQGDM
LLGWDTDEFPTDLYSATLTLYEVLKNGGLGKGGVNFDAKVRRGSFEDEDLFYAHIAGMDS
YARGLKAAAKLIEERILDDIIDNRYRSFNEGIGAEIVSGKATLASLEQYALQNNPIRNES
GRLERIRATLNEVIFSV

BLAST