GenomeNet

>pmq:PM3016_7068 hypothetical protein; K02358 elongation factor Tu (A)
MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAITTVLSKKYGGAAVAFDQIDKAPEERERG
ITISTAHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVEDEELLELVEMEVRDLLNEYEFPGDDTPIIRGAAREALQ
NPDGPWAEKIVELFEQIDTYIPTPERDTDKPFLMPVEDVFTITGRGTVATGRVERGVIKV
GDEIEIIGLAEETRKSVVTGVEMFRKLLDSAQAGDNIGALLRGVDRKDIERGQVLAKPGS
VKPHTNFSAQIYVLTKEEGGRHKPFFTGYRPQFYFRTTDVTGIINLPEGSEMVMPGDNIT
VTVELISPIAIEEGTRFAIREGGRTVGAGAVASISK

BLAST