GenomeNet

>pms:KNP414_00530 sodA; SodA protein; K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] (A)
MAHQLPALPYANNALEPHIDEMTMMIHHDRHHNTYVTNLNAALEAHADLQSKSVEELISN
LDALPEGIRTAVRNNGGGHANHSLFWETIGPNGGGAPSGKLADAINAELGGFDKFKEDFA
KAATTRFGSGWAFLSVTKDGKLKVASLPNQDSPIMEGETPVLGLDVWEHAYYLKYQNKRP
DYIAAFWNVVNWEEVGKRYEAAAK

BLAST