GenomeNet

>pms:KNP414_00548 ddlB; protein DdlB; K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] (A)
MHCFFFLISGTTDFINRRVLMSKIRVGLIYGGKSGEHEVSLQTALAVTKALDLSKYEVQP
FYITKEGDWRSGPQLTAPADSVDALTFGSASSSNETGTFALQPLFGSSAAAKASGNPAVS
GSESGAAAGPLDVVLPLLHGTFGEDGTVQGLLEMANIAYVGTGVLASAVGMDKVMMKKVF
AQEGLPQCVFRHFTKSQWEKDNAFFIMEIEVAIGYPCFVKPANLGSSVGINKARNRDELL
SAIAEAFRYDRKVIVEEFIDARELEVAVLGNDEPQASVVGEIVSSGEFYDYKAKYIDGKS
SMIIPAEIDSEQASRIRDLAVRAFQSIDGTGLSRVDFFLRKDNGEIYINEINTMPGFTPF
SMYPLLWRESGKPYSELLDDLVRLAIQRHEEKQRLQYSFDLT

BLAST