GenomeNet

>pms:KNP414_03247 K00169 pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1] | (GenBank) pyruvate synthase subunit PorA (A)
MAIEINKEVSTGTVEQRMVYESGNEMAAYAAHQINYHVMGYFPISPSTEVAQFLDLMKAN
GQHDIKLIPADGEHGSAGICYGASTAGGRVFNATSANGYLYMLEQMPVQSGTRFPMVMNL
VCRSVSGPLNIHGDHSDLYYALNTGWPILMCRDPQAVYDMNIMAIKLAEDPEVRLPVIVA
SDGYFTSHQKRRVQTFAHKSDVHAFIGEQPKQFPHVLDRNNPITVGPYMNEPDYINNCYQ
QSQAMYKAGEVFDRIQQEYKVLTGREYPILDLYRMEDAEVAVFLMNSASEIIKDVVDQLR
AQGIKAGSIAPNMIRPFPAKQIAEALKNVKAVTIGDRADSYGAHGGNMTLEIKAALFTEG
NRHTQVVSRVYGLGGKDFYAEDGHAFFELAIEAANAGQVNVPFDYYGHTPGDPSKRPERV
LEPMRYEDLKTGLITVNKDEATGQLKVKVPPLRSLTKKPKRLAPGHGACPGCGIFSGLEL
FFKGIEGDIVALFHTGCAMVVTTGYPYSSHKATYIHNLFQSGAATLSGVVEMFWERKRRG
ELDHLNLPDDFTFVMITGDGGMDIGMGPAIGAALRNHKMIILEYDNEGYMNTGAQLSYST
PLGHRTSTSNVGKHQGGKLFHHKDTPQIMASTNIPYVFTGSEANPQDLLKKAAKAQYYAQ
NEGLVYGKILITCPLNWLSEEQIGQTLIDQAVNSCFFPLYEIENGVTTITYNPEEKSKRI
PVGEWLKNMGKTKHMTKPEYAEALLSFENEVERRWKRLKAKHEHPDL

BLAST