GenomeNet

>pms:KNP414_07372 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) tdk; Tdk (A)
MNSGKSIEVLRVAHNYEEQGKKVLLFTPAVDDREGVGVVASRIGMRKDGIIIDEHLDMVA
MAAQERPNCILIDEAQFLTKAQVEQLTEITDTLGIPVITYGLRGDFLGQLFEGSMHLFAL
ADKIEEIKTVCWYCDRKATMNMRCKDGVPVFTGEQIQIGGNESYIPVCRKCYSRQKKTAA
AQ

BLAST