GenomeNet

>pms:KNP414_07372 tdk; hypothetical protein; K00857 thymidine kinase [EC:2.7.1.21] (A)
MNSGKSIEVLRVAHNYEEQGKKVLLFTPAVDDREGVGVVASRIGMRKDGIIIDEHLDMVA
MAAQERPNCILIDEAQFLTKAQVEQLTEITDTLGIPVITYGLRGDFLGQLFEGSMHLFAL
ADKIEEIKTVCWYCDRKATMNMRCKDGVPVFTGEQIQIGGNESYIPVCRKCYSRQKKTAA
AQ

BLAST