GenomeNet

>pms:KNP414_07524 tuf; hypothetical protein; K02358 elongation factor Tu (A)
MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAITTVLSKKYGGAAVAFDQIDKAPEERERG
ITISTAHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVEDEELLELVEMEVRDLLNEYEFPGDDTPIIRGAAREALQ
NPDGPWAEKIVELFEQIDTYIPTPERDTDKPFLMPVEDVFTITGRGTVATGRVERGVIKV
GDEIEIIGLAEETRKSVVTGVEMFRKLLDSAQAGDNIGALLRGVDRKDIERGQVLAKPGS
VKPHTNFSAQIYVLTKEEGGRHKPFFTGYRPQFYFRTTDVTGIINLPEGSEMVMPGDNIT
VTVELISPIAIEEGTRFAIREGGRTVGAGAVASISK

BLAST