GenomeNet

>pmu:PM1236 tdk; Tdk; K00857 thymidine kinase [EC:2.7.1.21] (A)
MAKLYFYYSTMNAGKSTTLLQSSYNYQERDMNTLVYTAAIDDRFGVGKVTSRIGISQEAQ
LFHKESDLFVEIAQHLQQQPLHCILVDEAQFLTKTQVYQLSEVVDKLKIPVLCYGLRTDF
QAELFEGSKYLLAWADQLEELKTICYCGRKANFVLRLNDKGEVVRDGAQIQIGGNDSYLS
VCRLHYKEKIAL

BLAST