GenomeNet

>pmv:PMCN06_2227 tdk; thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MNTLVYTAAIDDRFGVGKVTSRIGISQEAQLFHKESDLFVEIAQHLQQQPLHCILVDEAQ
FLTKTQVYQLSEVVDKLKVPVLCYGLRTDFQAELFEGSKYLLAWADQLEELKTICYCGRK
ANFVLRLNEKGDVVRDGAQIQIGGNDSYLSVCRLHYKEKIAL

BLAST