GenomeNet

>pmw:B2K_01500 protein-glutamine gamma-glutamyltransferase; K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] (A)
MIVLPESSFSVSAAVQMLPPLEREIYEQKHGSPNAFHYPSLAALLFELKLRSAIVEAAVQ
LQKSDAEFESFKDSRCSEAYWIRTEGGGFRQKPGVRTSEAIRDIYINGKAYAFECATAVI
IVLYKAVLETIGEEAFDRLFRYLFLMSWNHDSLLHLITVYGKGEVYPGDVQYVKNPDVDP
KAIEWQGENIVKLRGDRYFGHGVGIGDVDMFIRKLNRHRLPGSTVSAYLLDEATYPNFLA
LFEAAGTGQLPSYLPQLPMRSHGLIVSRIGTRTAIYS

BLAST