GenomeNet

>pmw:B2K_27485 cytochrome C oxidase subunit II; K01176 alpha-amylase [EC:3.2.1.1] (A)
MSRIWSRRKTAKVIVSAALAFTLIASPGTEKAHAHHDGSNGVMMQYFEWYLPNDGTLWSK
LQTNAAALKSAGVTAVWIPPAYKGGGSGDVGYGVYDMYDLGEFNQKGTVRTKYGTKDQLI
SAVDTLHANGMQVYGDVVLNHRMNADATETVTAVEVNPSDRNSEISGEYSISAWTQFHFP
GRNNAYSSFKWKWYHFDGVDYDQSRNANKLFKLRGTGKSFDWEVDTENGNYDYLMGADLD
WDHPEVISETRTWGNWFVNTAKLDGVRIDAVKHIKFDRMRDWLNGVRTDTGKSLFAVGEY
WSGDINKLNNYMTKTSGAMSLFDVPLHYNLYAASNGSGGYDMRNILNNTLLKTNPTKAVT
FVDNHDSQPGQALQSTVQGWFKPLAYALILTRQEGYPSLFYGDYYGTSDGKIASFKTVLD
KLLAARKTYAYGKQNDYLDHQDIIGWTREGDAAHANSGLAALVTDGPGGSKRMYVGTGKA
GQVWNDKTGNRTDTVTIDGSGYGTFPVNGGSVSVWAKQ

BLAST