GenomeNet

>pmw:B2K_34865 DNA polymerase; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MAAPVKPKSSSSKSAKGTIMVQGRELTITNPQKLLWPEKGITKAIYLEKLAQLAPYLLTY
CRGRYLTTIRFPDGWNEKSFYQKNVPEPTPDFVASAELEGIRYVHLDSLPTLLWLGNLAA
LEFHPSFHRIGSPLPAEWLIDIDPSLDPEPRIMEAAEIIGGILDGMNIRSVPKTSGATGV
QIYVPIPPEKGYTFEQLRKIGQFVANFAVQKHPQLFTVERLKKDRGTRIYIDYLQHWYGK
TLSAPYTPRAREAASVSTPLTWQEVAARPDPRDFHLLNIMERLQQKGDLIAQNPAQNLDP
ILSFLK

BLAST