GenomeNet

>pmw:B2K_34965 thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MAQLYFRYGTMNSGKSIEVLRVAHNYEEQGKKVLLFTPAVDDREGVGVVASRIGMRKDGI
IIDEHLDMVAMAAQERPNCILIDEAQFLTKAQVEQLTEITDTLGIPVITYGLRGDFLGQL
FEGSMHLFALADKIEEIKTVCWYCDRKATMNMRCKDGVPVFTGEQIQIGGNESYIPVCRK
CYSRQKKTAAAQ

BLAST