GenomeNet

>pmy:Pmen_3133 alpha amylase, catalytic region; K01176 alpha-amylase [EC:3.2.1.1] (A)
MRRPSLPTSLTTLACALLCQFASAEPQLQAWLDQRPVPLQWSNPAPQRYSVELELSAGQL
RLQAPNASGSAQPLALYQRQDWHARSSLSLQIGEPGRYRLLFQEDAQPHLRLLPLREQAP
RSACRTWQGEALSVAVGQVFADGEVLRDAYSGQLATVENGRIELTPAAHSDGLLLLEPAE
PAPAPAHDWRNATVYFAITDRFANGDTGNDRSYGRQPDGEQEIGTFHGGDLRGLTGKLDY
LQQLGVNALWISAPFEQIHGWVGGGDKGDFRHYAYHGYYALDFTRLDANMGTEDELRELI
AQAHARGIRVLFDVVLNHPGYSTLADMQVLGFGALRGGMDQYLPPRWSDWQPESFENLHA
YHNLIDYQHDAWRQWWGKDWVRADIADYDSPPSVLVDPRQGSLAFLPDFKTESQQPVSLP
PFLLRKADTRAVPREGYRVRDYLVEWLSFWVREFGVDGFRADTVKHVELESWAALRQAAD
KARAEWSAANPDDPMSGSPFWMVGEVFGHGPQASVYQDHGFDALINFDFQGELAARGSEC
LRQVEDGYRDYAELLANDARHNFMSYASSHDTSLFFAEQGERLARQRGLACALLLAPGAV
QIYYGDESARPLGPTGSDPHQGTRSSMNWDAQQQAPVAELLAHWRLLGQFRARHPAIGAG
RHQQLSSQPYAFARTLGKDRVVIVQGR

BLAST