GenomeNet

>pno:SNOG_01866 hypothetical protein; K15102 solute carrier family 25 (mitochondrial phosphate transporter), member 3 (A)
MANQQGAKITVYWLEKSRGQRAVWLLEELGLEYELKVFKRDENFRAGDDLGAVHPLKRSP
VVGITPAGSEKEIILAESATIVDYVSEHFGKQLIPQRYPDGKEGVLGAETEEFMRHRFLM
DYAEGSFFTILMIALVIGNVKNAPVPFFIKPLTRGIANKVETTFINPELKKHCDFLEDFM
SKSSGEFFVGDKLTGADIMMHFGLEGACQRVPLTESTYPKLYQYMRRMQKRDAYERAAKR
VSEASGETYVPYSDLKIMKREEYESSINKDTNINRIRGEGFKTWLNTLGAKRSEWTAGRQ
QHVVPLSEIARRQAKRFYFASSTISVRPASPASSSPLSTPSAVAHLSAANMATSPPPTST
GSSKVDAAKANIAANIDPTAPTGLALYSRFAFAGAVCCSVTHGALTPVDVVKTRIQLDPA
TYNNGLIGGFRKVIANEGAGAVWTGFGPTAAGYFLQGAFKFGGYELFKQQAINMVGYETA
SNNRTAVYLASAACAEFFADIALCPLEATRIRLVSEPTFANGLIGGFGKILKNEGVGAFY
SGFGPILFKQVPYTMAKFVVFEKVNEAIYQVVDKTKTSNGMQTVYNLSSGLVAGFAAAII
SQPADTMLSKINKSKGLPGEGTTSRLIKIAKELGLRGSYSGIGARLFMVGTLTAGQFAIY
GDIKKALGATGGVEIAKTN

BLAST