GenomeNet

>pno:SNOG_01869 K01176 alpha-amylase [EC:3.2.1.1] | (RefSeq) hypothetical protein (A)
MGSEEQKPTPENNTLLQGYEWNCPSDNKHYKRLAAEVPKLKAIGINNIWLPPGCKAANPK
GVGFDIYDLYDLGEFDQKGTRATKWGSKEDLLELSKIAKENGVGLYWDAVLNHKAGADKT
EKCRVVEVDNEDRTKEVGEPYEIEGWLGFDFAGRGDKYSSMKYHWEHFSGTDYNQANEKK
AIYKIVGDNKGWSNSVDNEGGNADYMMFADIDYRHPEVQEDVKNWGVWITKELGLKGFRL
DAVQHFSERFTNEWIENVREQCGKDIFMVGEFWSGDRTVMIDWLADLDHKFSLYDSPLLN
NFARLSTTPDADLRTVFDGSLVQAEPVNAVTVVTNHDTQPGQTMETKIEGFFVPLAYSLI
LLRKEGYPCPFYGDLYGLNEPHETPASCGGKLADLILARKLYAYGDQEDYWNDPNLIGFV
RRGTWDKPAGLACLMSNKGPGEIKMAVGEMHAGEKWTDVLGWEEGEVEIDQDGYGLFKCP
GTSVAIWVKADAQGRDQFPVNFDADIYGKA

BLAST