GenomeNet

>pno:SNOG_05556 hypothetical protein; K01312 trypsin [EC:3.4.21.4] (A)
MHFTDVLIALAAPALISAAAIPQDPEFPEGEFPEDPIVGGTTASAGDFPFIVSIQQGGSH
FCGGSLLNANTVLTAAHCAVGQTASSLQIRAGSLSRTSGGTVVKVSSIKVNPSYAAGTYN
NDVAIMKLATSIPTSSTISYAKLASSGSDPAAGTGLTVAGWGTTSSGGQSLPVNLLKVDV
PVISRSTCNSNYGSGRITTAMFCAGLSQGGKDSCQGDSGGPIINTSSRVQVGVVSWGEGC
ASAGAPGVYSNLGQSSLASFVAANL

BLAST