GenomeNet

>pno:SNOG_11641 K00823 4-aminobutyrate aminotransferase [EC:2.6.1.19] | (RefSeq) hypothetical protein (A)
MDAAAFGEQHIAKGIGRLTKHVFEEGNGTWITTDKGVKLLDLTAGIGVVNLGHCHPKVSA
AAAKQCGKITHAQVNIGFSSAQITLLKELIPILPDPSLDTVFLWNSGAEAVEAAVKLARA
ATKKPNIIVMQGSYHGRTNATSSMTRSKTIYGEGHGPLMGGVFATAFPYYSQFGGATPGT
PTEELVNQSLLQLKLTLQQQTSPADTAAIILEPVLGEGGYVPAPPAFMHGLRKICDEHNI
LLIADEVQSGMGRTGHMWFVEESGVRPDILIFAKGIANGFPLSGIASSKEFMDRQKPGSM
GGTYAGNAVACAAATATIQAFKEERILDNVAARSKQIFSFLNNLKSSGTKAGNLIEDVRG
SGLMVGVQFANPALQRDSSNVASKDAQSQPQLAPKIVQECVKRNMLLLSTSVFDVLRFIP
PLTISEDEMTQACNIFKESLEAVAKDL

BLAST