GenomeNet

>pno:SNOG_15514 hypothetical protein; K00693 glycogen(starch) synthase [EC:2.4.1.11] (A)
MAETTTRDVNNHVLFEVATEVANRVGGIYSVLKSKAQVTTAEYGASYTLIGPWNRASASV
EVEPIEPKDPALVATIKSMQDRGVQTLYGRWLIDGAPRVLLFDTGTGYRWLDEWKGDLWS
SAGIPSPPGDSETNEAIVFGYLVAWFLGEYVFHEKKRAVIVQFHEWLAGVAVPLCKKRRI
DVTTIFTTHATLLGRYLCAGSVDFYNNLQFFDVDAEAGKRGIYHRYCIERAATHAADVFT
TVSHITAYESEHLLKRKPDGVLPNGLNVKKFSATHEFQNLHQQAKVKINDFVRGHFYGHN
DFDPENTLYFFTAGRYEYRNKGVDMFIESLARLNHKMKSENSNMTVVAFIILPAQTQSLS
VASLKGQAVIKSLHDTVNNIAENVAKKLFERSLTWTEGQDLPEDKDLISPADKILLRRRL
FAMKRHDLPPIVTHNMVNDAEDPVLAQLRRCQLFNHPSDRVKVVFHPEFLNSANPVLPLD
YDDFVRGTHLGVFSSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENASDYGIYI
VDRRMKGVDDSVNQLVDYMFDFTKKSKRQRINQRNRTERLSDLLDWKRMGLEYVKARQLA
LRRAYPGSYEDDEEPDFFGSQEVKISRPLSEPGSPRDRSGMMTPGDFASLQEGREGLSTE
DYIAWKLPEEEEPDDFTFPLTLKTKSKPNSGANTPTIINGTDGLSLN

BLAST