GenomeNet

>pno:SNOG_15620 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) hypothetical protein (A)
MDTTSSSSRPTKATVAPKNPSLSWSTRWRDTAWLSLGTHTVVVVLGFVLLAPLLAPHFPD
TLHEIFDRTQHWRTSSPSVTLRNPLVFQEQQICPKPKQHVEFKGTFNTRPERSMALADQA
KQVAAEFDFKQDAVNKAVKEFIREMDEGLQSEGTELSQIPTYVTAVPNGTEKVPLHTRDG
LYMAVDLGGTNFRVCSIQLHGNTTFSLTQSKVAIPRELMVAKTSKELFSFLAKQIELFLK
AHHEEHYVGTLKRRELGGGEIAEEEIFNLGFTFSFPVNQIGINKGMLMRWTKGFDIQDAV
GKDVCALLQTEIDELHLPVKVAALVNDTVGTLMARSYTSPGKTGTLLGAIFGTGTNGAYV
EKLDRVTKLTKDKNAGDYDKSTGEMIVNTEWGSFDNSLRTLPNTPYDVELDKKSVNPGIQ
MFEKRVSGMFLGELLRLALLKLIKDPAVPLFADDNSASNDVHSTTQIHDGSSIWKQWGID
TSFLSVCAGDTSPGYRMLRQTLDKEYEISAVSAEDAEAVREIAVAIGRRAARLSAVAIGA
IVINTGRLSKTAGAATTEQKSGIAPARGEVEVADEDVIDVGVDGSLVEFYPNFEEHIRDA
LRGIPEIGEQGEKRIRIGIAKDGSGVGAALIALVAGKVASPA

BLAST