GenomeNet

>pol:Bpro_0032 RuBisCo-like protein; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MNADRFEATYLIETPLEPARVAEVMAGEQSCGTFTRVEGETDALRLRARATVESIEELAS
VNAPSLPNALLERQGHTAPHGGPWRRARVRISFPVANVGANLPTLAATVSGNLYDLGEAS
GLRLESMKLPAAYRAQFDRPRVGIAGTRQATGVASGALVGTILKPNVGFSAAQTAELVGR
LCAAGVDFIKDDEVCADPAHAPLAKRVPAVMAVVRAHQQRTGKHVMVAFNITDETDAMKR
HADLVEREGGSCVMASLNWCGHSALQTLRRHTGLALHGHRNGYGALSRHPLLGMSFQAYQ
TLWRLAGVDHMHVHGLQGKFSQPDAEVIESAHDCYTPLADGADGFDDRVMPAFSSGQWAG
TVPATWAAVQSDDLLFMSGGGILAHPGGPAAGVASIRQAWAAARQGVALAEFAREAPELA
AALAFFGK

BLAST