GenomeNet

>pol:Bpro_2962 glutathione S-transferase-like protein; K11209 GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-] (A)
MINVYSWPTPNGHKVHVMLEECGFRLGRDWQAFPVNIGKGDQFKPDFLAISPNNKIPALV
DPHGPDGKPISLFESGAILLYLAAKTGKLLPKSDRLKFQVLQWLMFQMGSVGPMIGQTHH
FRQYAPEKIDYAVNRYTNETRRLYGVMDRQLATSKFIACNQYTIADVAIFPWLRNWANHG
IDWADYPHLKKWFDLVSARPAVQRGVQVLADLRRPLTGDKERDILFGKTQYAKR

BLAST