GenomeNet

>pol:Bpro_4661 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) glutathione S-transferase-like protein (A)
MKLIGSATSPYVRKVRIVMAEKKLDYQMVLEDVWAANTTITASNPLGKVPCLVMEGGEAV
FDSRVIVEYLDTLSPVGKLIPTQGRERAEVKTWEALADGLVDAAILARLEATWAGRSAHE
RSDAWIQRQMGKIEAALKAMSTGLGEKAFCSGIHFSLSDVAVGCALGYLDLRFAQVNWRE
SYPNLAKLQEKLVLRPSFTETQPG

BLAST