GenomeNet

>pon:100440931 coagulation factor XIII A chain-like; K03917 coagulation factor XIII A1 polypeptide [EC:2.3.2.13] (A)
MGNWESEGPFEEVPEAHRASPREGTSGGHRLQVSMVMLELCGQFPSLEGDQCLKAQIDAA
LHIAKGKGKCCLSSKPDTCPGVVDWCPRVTVTLDDLISNSEIREVSSTIQVWEKKFTEQK
GIFSQLVEFEGLRQTCSSEVCLPVFQGLLDFRTEEDLNEPNFLVLTMEHNGVQRDQASCT
GFMCEEFLNVTSVHLFKERWDTNKVDHHTDKYENNKLIVRRGQSFYVQIDFNRPYDPRRD
LFRVEYVIGDRYPQENKGPTXPSAIVSELQSGKWGAKIVMREDRSVRLSVQSSPKCIVGK
FRMYVAVWTPYGVLRTSRNPETDTYILFNPWCEDDAVYLDNEKEREEYVLNDIGVIFYGE
VNDIKTRSWSYGQFEDGILDTCLYVMDRAQMDLSGRGNPIKVSRVGSAMVNAKDDEGVLV
GSWDNIYAYGVPPSAWTGSVDILLEYRSSENPVRYGQCWVFAGVFNTFLRCLGIPARIVT
NYFSAHDNDANLQMDIFLEEDGNVNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVD
STPQENSDGMYRCGPASVQAIKHGHVCFQFDAPFVFAEVNSDLIYITAKKDGTHVVENVD
ATHIGKLIVTKQIGGDGMMDITDTYKFQEGQEEERXALETALMVVKVIFMEKNSQFKKEA
VLIQAGEYMGQLLEQASLHFFVTARINETRDVLAKQKSTVLTIPEIIIKVRGTQVVGSDM
TVTVEFTNPLKETLRNVWIHLDGPGITRPMRKMFREIRPNSTVQWEEVCRPWVSGHRKLI
ASMSSDSLRHVYGELDVQIQRRPSM

BLAST