GenomeNet

>pon:100443026 K01312 trypsin [EC:3.4.21.4] | (RefSeq) trypsin-1 isoform X2 (A)
MNPLLILAFVGAAVAAPFDDDDKIVGGYTCQKNSLPYQVSLNSGYHFCGGSLINEQWVVS
AAHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTVNNDIMLIKLSTPAVIN
ARVSTISLPTAPPAAGTECLISGWGNTASSGADYPDELQCLDAPVLSQAECEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQKNRPGVYTKVYNYVDWIK
DTIAANS

BLAST