GenomeNet

>pon:100446578 K00799 glutathione S-transferase [EC:2.5.1.18] | (RefSeq) glutathione S-transferase A3 isoform X1 (A)
MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIESPEDLEKLRNDGSLMFQQVPMVEI
DEMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAK
IALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISSFPL
LKALKTRISNLPMVKKFLQPGSPRKPPADAKALEEARKIFRF

BLAST