GenomeNet

>pon:100451760 SETD8; SET domain containing (lysine methyltransferase) 8; K11428 histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43] (A)
PAERRSGAPIGASSWSPAEQLAAVVATFFESWVSREIPGGDRVEPWLEENVFTGQSKIYS
YMSPNKCSGMRFPLQEENSVAHHEVKCQGKPLAGIYRKREEKRNAGNAVRSAMKSEEQKI
KDARRGPLAPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQ
QNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQF
SRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRL
INHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH

BLAST