GenomeNet

>pon:100461473 NSD1; nuclear receptor binding SET domain protein 1; K15588 histone-lysine N-methyltransferase NSD1 [EC:2.1.1.43] (A)
MDQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNA
YGQDSPSCYIPLRRLQDLASMINVEYLNGSADGSESFQDPEKSDSRAQTPIVCTSLSPGG
PTALAMKQEPSCNNSPELQVKVTKTVKNGFLHFENFTCVDDADVDSEMDSEQPVTEDESI
EEIFEETQTNATCNYETKSENGVKVAMGSEQDSTPESRHGAVKSPFLPLAPQTETQKNKQ
RNEVDGSNEKAALLPAPFSLGDTNITIEEQLNSINLSFQDDPDSSTSTLGNMLELPGTSS
SSTSQELPFCQPKKKSTPLKYEVGDLIWAKFKRRPWWPCRICSDPLINTHSKMKVSNRRP
YRQYYVEAFGDPSERAWVAGKAIVMFEGRHQFEELPVLRRRGKQKEKGYRHKVPQKILSK
WEASVGLAEQYDVPKGSKNRKCIPGSIKLDSEEDMPFEDCTNDPESEHDLLLNGCLKSLA
FDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFISG
DISDTQASNELSRIANSLTGSNTAPGSFLFSSCGKNTARKEFETSNGDSLLGLPEGALIS
KCSREKNKPQRSLVCGSKVKLCYIGAGDEEKRSDSISICTTSDDGSSDLDPIEHSSESDN
SILEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSAE
PGTETSQVKLSDLKASTLVHKPQSDFTNDAVSPKFNMSSSISSENSLIKGGAANQALLHS
KSKQPKFRSIKCKHKENPVVVEPPVINEECSLKCCSSDTKGSPLASISKSGKVDGLKLLN
NMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHIP
IEPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGG
STHNSEKKGDGIQNSANPSPSGGDSALSGELSASLPGLVSDKRDLPASGKSRSDCVTRRN
CGRSKPSSKLRDAFSAQMVKNTVNRKALKTERKRKLNQLPSVTLDAVLQGDREHGGSLRG
GAEDPSKEEPLQIMGHLTSKDGDHFSDVHFDNNVKQSDPGKISEKGLSFENGKGPELDSV
MNSENDELNGVNQVVPKKRWQRLNQRRTKPRKRMNRFKEKENSECAFRVLLPSDPVQEGQ
DEFPEHRTPPSASILEEPLTEQNHADCLDAVGPRLNVCDKSSASIGDMEKEPGIPSLTPQ
AELPEPEVRFQNKRLKKPSKWLLEYTEEYDRIFAPKKKQKKVQEQVHKVSSRCEEESLLA
RGRSSAQNKQVDENSLISTKEEPPVLEREAPFLEGPLAQSELGGGHAELPQLTLSVPVAP
EVSPRPALESEELLVKTPGNYESKRQRKPTKKLLESNDLDPGFMPKKGDLGLSKKCYEAG
HLENGITESCATSYSKDFGGGTTKIFDKPRKRKRQRHAAAKMQCKKVKNDDSSKEIPGSE
GELMPHRTAASPKETVEEGVEHDPGMPASKKMQGERGGGAALKENVCQNCEKLGELLLCE
AQCCGAFHLECLGLTEMPRGKFICNECRTGIHTCFVCKQSGEDVKRCLLPLCGKFYHEEC
VQKYPPTVMQNKGFRCSLHICITCHAANPANVSASKGRLMRCVRCPVAYHANDFCLAAGS
KILASNSIICPNHFTPRRGCRNHEHVNVSWCFVCSEGGSLLCCDSCPAAFHRECLNIDIP
EGNWYCNDCKAGKKPHYREIVWVKVGRYRWWPAEICHPRAVPSNIDKMRHDVGEFPVLFF
GSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKKALQEAAARFEELKAQKELRQLQE
DRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYE
CHPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKIDIKKGEFVNEYVGELIDEE
ECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTR
VGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPIATEEKSKKF
KKKQQGKRRTQGEITKEREDECFSCGDAGQLVSCKKPGCPKVYHADCLNLTKRPAGKWEC
PWHQCDICGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHDPCGPNPLEPGEIR
EYVPPPVLLPPGPSTHLAEQSTGMAAQAPKMSDKPPADTNQTLSLSKKALAGTCQRPLLP
ERPLERTDSRPQSLDKVRDLAGSGTKSQSLVSSQRPLDRPPAVTGPRPQLSDKPSPVTSP
SSSPSVRSQPLERPLGTADPRLDKSIGAASPRPQSLEKTPVPTGLRLPPPDRLHITSSPK
PQTSDRPPDKPHASLSQRLPPPEKVLSAVVQTLVAKEKALRPVDQNTQSKNRAALVMDLI
DLTPRQKERAASPHEATPQADEKMPVLESSSWPASKGLGHMPRAVDKGCVSDLLQTSGKA
AAPSEDPWQAVKSLTQARLLSQPPAKAFLYEPTTQASGRAPAGAEQTPGPLSQAPGLVKQ
AKQMVGGQQLPALAAKSGQSFRALGKAPASLPAEEKKLVTTEQSPWALGKASSRAGLWPI
VAGQTLAQSCWSAGSTQTLAQTCWSLGRGQDPKPEQNTLPALNQAPSSHKCAESEQK

BLAST