GenomeNet

>pop:POPTR_0018s10460g POPTRDRAFT_737826; hypothetical protein; K01805 xylose isomerase [EC:5.3.1.5] (A)
MKGGRILLLLVCSSVITLGVFAAGPPTCPADLGGKCSDSGEWEGEFFPGIPKIKYEGPSS
KNPLAFKWYNAEEEILGKKMKDWMRFSIAFWHTFRGTGGDPFGAPTKYWPWEDGTNSLAM
AKRRMRANFEFLEKIGVDRWCFHDRDIAPDGETLEESNKNLDEVVALAKELQGTKIRPLW
GTAQLFMHPRYMHGGATSSELGVYAYAAAQVKKAMEVTHDLGGENYVFWGGREGYQSLLN
TDMERELDHLARFCEAAVAYKKKIGFIGTLLIEPKPQEPTKHQYDWDAATTANFLRKYGL
IGEFKLNIECNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFMTDISEAT
MVMISVIRNGGLAPGGFNFDAKLRRESTEVEDIFLAHISGMDTLARGLRSAAKLIQDGSL
AELVRKRYQSFDTEIGAQIEAGKGDFETLEKLAMKWGEPKVPSAKQELAEMIFQSAL

BLAST