GenomeNet

>pop:POPTR_745223 hypothetical protein (A)
MASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQECYELSAEYE
GKHDPKKLEELGSVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNKLKKGDFAD
ENNATTESDIEETLKRLVSEMKKSPEEVFDALKNQTVELVFTAHPTQSVRRSLLQKHARI
RNCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW
KGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLARM
MAANLYYSQIEDLMFELSMWRCSDELRLRADELHRSSKRDAKHYIEFWKQIPPNEPYRVI
LGELRDKLYQTRERSRQLLSHGISEIPEEATFINVEQFLEPLELCYRSLCSCGDRTIADG
SLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITKHLEIGSYREWSEERRQEWLLSEL
RGKRPLFGPDLPKTEEISDVLDTFHVIAELPADNFGAYIISMATAPSDVLAVELLQRECH
VKQPLRVVPLFEKLADLEAAPAALVRLFSIDWYRNRINGIQEVMIGYSDSGKDAGRFSAA
WQLYKAQEELIKVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGSLRVTVQG
EVIEKCFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEMAVVATEEYRSIVFK
EPRFVEYFRLATPEMEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRFHLPVWLGF
GAAFKHIIQKDIRNLHMLQEMYNAWPFFRVTIDLVEMVFAKGDPGIAALNDKLLVSEDLW
AFGEKLRADYEETKGLLLQIAGHKDLLEGDPYLKQRLRLRDSYITTLNVCQAYTLKRIRD
PNYNVTTRPHISKEIMESSNPADELVKLNPTSEYGPGLEDTLILTMKGIAAGMQNTG

BLAST