GenomeNet

>ppa:PAS_chr1-4_0447 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) Hexokinase isoenzyme 2 that catalyzes phosphorylation of glucose in the cytosol (A)
MVPVLTPQFHSSPSVSDFTAFINRSNVVSITSNLYESYKEAIHSSNVSMYCTNSSTPTGN
ECGTCLVVELGGSTLRIAVLRLEKRKYENLYQRDWTLTESDKVIDLKFFDEIAQKITNIP
SLRSHFRNDTIRIGISWSFPLEQTSSSQAVLQTMGKGFRLSESTHGQDLKTLFENSLKSN
GIDASVESIINDSVAVFVAGNYLESCVTGLVAGTGVNCALVVDRKMIGLQKSQEQIRPLR
KGNFDKVVLNSELGFFGGFLCQHSTIWDKMVHENWALHHSVQTNQPHMTLALGCFQPIEM
MCSGRYIGELTRLAILSLIDSKQLFKGSRQNIPSAFNVPYSLGGAIVSEIYESEGHLPEL
WAPLAPSQEDYQILFKVVDSIIERASVVLGCAIIALLKLSESSATIDPTGSGSCRPYRIG
YVGSVLKCFKPYREKVEMVLNLASKLQIINRPASLIYIDDSNLVGAAVSVFTPE

BLAST