GenomeNet

>ppa:PAS_chr1-4_0447 Hexokinase isoenzyme 2 that catalyzes phosphorylation of glucose in the cytosol; K00844 hexokinase [EC:2.7.1.1] (A)
MVPVLTPQFHSSPSVSDFTAFINRSNVVSITSNLYESYKEAIHSSNVSMYCTNSSTPTGN
ECGTCLVVELGGSTLRIAVLRLEKRKYENLYQRDWTLTESDKVIDLKFFDEIAQKITNIP
SLRSHFRNDTIRIGISWSFPLEQTSSSQAVLQTMGKGFRLSESTHGQDLKTLFENSLKSN
GIDASVESIINDSVAVFVAGNYLESCVTGLVAGTGVNCALVVDRKMIGLQKSQEQIRPLR
KGNFDKVVLNSELGFFGGFLCQHSTIWDKMVHENWALHHSVQTNQPHMTLALGCFQPIEM
MCSGRYIGELTRLAILSLIDSKQLFKGSRQNIPSAFNVPYSLGGAIVSEIYESEGHLPEL
WAPLAPSQEDYQILFKVVDSIIERASVVLGCAIIALLKLSESSATIDPTGSGSCRPYRIG
YVGSVLKCFKPYREKVEMVLNLASKLQIINRPASLIYIDDSNLVGAAVSVFTPE

BLAST