GenomeNet

>ppa:PAS_chr2-1_0343 hypothetical protein; K01580 glutamate decarboxylase [EC:4.1.1.15] (A)
MTPIKTDLEADRVTELETLLRPAVELIAQHIKDTDENDKPIGPYYPNPRDLYQSLKLEAD
FNGGGKDDELVIQTVKKVLDSSVNTWNAGFMDKLYASTNVIGLVSDLLLSALNTNSHVFT
VSPAVTIIEKYTARQYAGLFGFLGPRAGGLTFPGGSWSNVTSLQMARSSLYPDTKVKGNG
NHHFAVFASSHSHYSVEKACILLGIGAENLFKCKVDKNGCMDVTDLRVNIEKSIAEGYTP
LYINATAGTTVFGSYDSFEDIHKIAKEYKCWFHIDGSWGGNVIFSDREKHKMKGSHLADS
ITANPHKMLGVPCTCSFLLVPDVSIFQQANSLNAPYLFHNKHEDDDENYDLADGTMGCGR
RADSLKFYLSWLYYGSEGYKERVDHAFSIARYFTSKIVNRKGFKLVGSPEPACLQVCFYY
NPKNDFENGSENTNATRYIATELHKHGKFLVDYSPNPDDVDNQHGEFFRVVFNSPILDDK
TIDSLIDLIEQTGEEIV

BLAST