GenomeNet

>ppa:PAS_chr4_0530 Cytosolic aspartate aminotransferase, involved in nitrogen metabolism; K04371 mitogen-activated protein kinase 1/3 [EC:2.7.11.24] (A)
MASGQRSISFNVSHHYQILDIVGEGAYGVVCSAIHLPSQQKVAIKKIVPFSKPMFCLRTL
RELKLLKHFNHENIISILDIQVPYDFSSFHEVYLIQELMETDLHRVIRTQQLSDDHCQYF
VYQTLRALKALHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSVAKTEDNYGFMTEYVA
TRWYRAPEIMLTFQEYTAAIDVWSVGCILAEMLSGTPLFPGKDYHHQLSLIFDVLGTPGK
EDLAAIKSPRPREYVGSMTPRPGVDFKTLFPGANPLGLDLLSRLLTFSPARRICVDDALR
HPYLQLYHDPNDEPVAAPLEDDFFDFDRRKEELTMLDLKELLYEEIIKPLQ

BLAST