GenomeNet

>ppa:PAS_chr4_0624 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) Non-essential protein of unknown function required for transcriptional induction (A)
MSLQEAVKEIQSSFDVSQEVLQRSVDKFIELAKKGLASNEDKLGMPMLPAYVTQVPSGKE
KGTYLAADLGGTNFRVCSVHLKGDNTFNLVQQKSPIPADMMVGTGDQLFAYLASKIRKFL
EEHHGDALEAAHETNSRANYLKLGFTFSFPTAQHSLDSGSLVRWTKGFNIPDVVDQDVVQ
LLQKHLDAGKIPVHVAALANDTVGTLLSRAYSANAIAGGKQGETIIGAIFGTGTNGAYLE
KLDNIKKLPEAVVKDLKAKGVTHMVINTEWGSFDNRLEVLPTTKYDRDVDALTANPGIHL
FEKRVSGMFMGEILRNILVDFHSRGLVFTQYPNFESLPHRLRTPWDLDSENLSLFEVDDS
KDMKPTEVTLLQALRLPTTLEERQAIQALTRAISRRSAYISAVPIAAIIMLTGALEGHHI
EVDIGVDGSVVEFYPGYRTMLRDALALTQIGTKGERRTHINIAKDGSGVGAALCASVSI

BLAST