GenomeNet

>ppa:PAS_chr4_0624 Non-essential protein of unknown function required for transcriptional induction; K00844 hexokinase [EC:2.7.1.1] (A)
MSLQEAVKEIQSSFDVSQEVLQRSVDKFIELAKKGLASNEDKLGMPMLPAYVTQVPSGKE
KGTYLAADLGGTNFRVCSVHLKGDNTFNLVQQKSPIPADMMVGTGDQLFAYLASKIRKFL
EEHHGDALEAAHETNSRANYLKLGFTFSFPTAQHSLDSGSLVRWTKGFNIPDVVDQDVVQ
LLQKHLDAGKIPVHVAALANDTVGTLLSRAYSANAIAGGKQGETIIGAIFGTGTNGAYLE
KLDNIKKLPEAVVKDLKAKGVTHMVINTEWGSFDNRLEVLPTTKYDRDVDALTANPGIHL
FEKRVSGMFMGEILRNILVDFHSRGLVFTQYPNFESLPHRLRTPWDLDSENLSLFEVDDS
KDMKPTEVTLLQALRLPTTLEERQAIQALTRAISRRSAYISAVPIAAIIMLTGALEGHHI
EVDIGVDGSVVEFYPGYRTMLRDALALTQIGTKGERRTHINIAKDGSGVGAALCASVSI

BLAST