GenomeNet

>ppb:PPUBIRD1_0999 sodA; SodA protein (EC:1.15.1.1); K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] (A)
MPHTLPALPYAYDALEPHIDAQTMEIHHTKHHQTYVNGLNAALEGTEWAEWPVEKLVAAV
KQLPENLRGAVTNHGGGHANHSLFWTVMSPQGGGEPVGQLAQAVTAQLGGFEAFKEAFTK
AALTRFGSGWAWLSVTPQKTLMVESSGNQDSPLMHGNAPILGLDVWEHAYYLKYQNRRPE
YIGAFYNVIDWVEVERRYLEALK

BLAST