GenomeNet

>ppb:PPUBIRD1_2040 alr; hypothetical protein; K01775 alanine racemase [EC:5.1.1.1] (A)
MDNGTNTLTVQNSNAWVEVSASALQHNIRTLQAELAGKSKLCAVLKADAYGHGIGLVMPS
IIAQGVPCVAVASNEEARVVRASGFTGQLVRVRLASLSELEDGLQYDMEELVGSAEFARQ
ADAIAARHGKTLRIHMALNSSGMSRNGVEMATWSGRGEALQITDQKHLKLVALMTHFAVE
DKDDVRKGLAAFNEQTDWLIKHAKLDRSKLTLHAANSFATLEVPEARLDMVRTGGALFGD
TVPGRTEYKRAMQFKSHVAAVHSYPAGNTVGYDRTFTLARDSRLANITVGYSDGYRRVFT
NKGHVLINGHRVPVVGKVSMNTLMVDVTDFPDVKGGNEVVLFGKQAGGEITQAEMEEING
ALLADLYTVWGSSNPKMLVD

BLAST