GenomeNet

>ppb:PPUBIRD1_2515 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ligD; LigD (A)
MAKPLQEYARKRDFNATPEPSGKRKRGKRAHALQFCIQKHDASHLHYDFRLELDGTLKSW
AIPKGPSLDPKVRRLAVHVEDHPLDYADFEGHIPEGHYGAGDVIVWDRGIWEPEGDAHEA
YAKGKLRFRLQGEKLAGVWNLFRTHLAGKKEQWMLVKSHDAQARSETEYSIVEALPDSVL
SERTLVPRKSAAKKATAPRSSRKRADKVQAAPLPAQLQPQLATLVDSPPSGDWRYEVKFD
GYRILARIEGQDIRLFTRNGHDWSSKMPRQVAALRALGIDTAWLDGEMVVADENGMADFQ
ALQNAFDTEHDERITYYLFDLPFLGGQDLRQLPLQQRRDTLRQLLEHNHCDVIKYSADFD
EPVESLLDSACRLKLEGLIGKRADSVYSGRRSPDWIKLKCKQRQEFVIVGYTDPKGSRSG
FGALLLALHDNESGELRYAGKVGTGFNTTTLTSIHTRLKPLEIASPALPSPPAGAEARGV
HWLRPQLLAEVAFAQMTRDGIVRHSVFHGLRDDKAATAIDLERAMPAKTVSNRHKQANAS
ENLGELRLTHPDRVIDPTTGVTKREVAEYYAGISQWILPQLKHRPVALVRAPDGLGGELF
FQKNAGQLHIPNVLSYEKAEAGQAAMVINRPDTLLGAVQMNTLELHTWNATDKDFDKPDR
FVLDLDPDPALPWKAMVEATQLALTLLDELGLKVFLKTSGGKGIHVVVPLTRRAGWDEVK
DFSHAIVSYLAKLFPERLSAVSGPKNRVGRIFIDYLRNGKGATTACAYSLRARDGLPVSV
PIWREELAQIKAANQWNITNLHERLAEVDDPWADMGKVRQSITARMRKQLGLER

BLAST