GenomeNet

>ppc:HMPREF9154_1362 D-ala D-ala ligase N-terminal domain protein; K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] (A)
MSERTKIALVFGGKSSEHGISCLTAASVLGAIDRERFDIVAVGISKSGRWSRMSLEEVAD
LHITGDATPEVPEPEHDAVWLVGEHGGQVATRVGDQLVDIQEVDVVFAPLHGPYGEDGTI
QGMFEMMGIRYVGPGVLASAVGMDKHFMKLAFEAAGLPVGPYVVASERRLRLERKAVLAE
VAGLGFPVFVKPARGGSSIGITRVTDPSGLEDAIAEAQRHDPKVIFEQGFVGTRELEVAV
LGDPGSPEGCRASVVGEIRVQDGDGFYDFATKYLDDDGAALDAPARTTPELAARLRELAC
RAFNALDAEGLVRADFFATEDQAWINEVNTMPGFTRISMYPALWQASGIPYPELVTRLIE
LALERPVGLR

BLAST