GenomeNet

>ppd:Ppro_1026 dehydrogenase catalytic domain-containing protein; K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] (A)
MPKWGLTMEEGTLAKWLIDEGSQIEPGMAIAEVETDKIVNVMEANQSGVLAKQIADEGDV
LPVGALIGVITQGDAAESAIADFIANFGSDEEAAPAEESACSAASDDIYCLTMPKWGLTM
EEGTLVKWLIDEGTQIELGMSIAEVETDKIVNVLEATHAGILRRKIADEGDELPVGALLG
VIADASVSDQAIDAFLAGGATETAAEDASVPAAEEPQAESAAAGQILDGSLPLEGMRAAI
SKTVTTSWTTIPHYMVTVAIDMGRAEALSSAQKQAGKRVSINDMLIKASALAIGKYPLIN
AAFSGKNITLHGDVNVAMAIGLEEGVIMPVIRECQKLPVQQIGERSRELVALAKEGKLGS
AELSGGTFAISNMGMLGVEDFIAIVPPNLSAILAVGMVKDEPVVRDGQVVAARMMRVTVS
ADHRVHDGAYAAKFLGELKGILEAPETILA

BLAST